PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR12G02240.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 214aa    MW: 23293.2 Da    PI: 8.4172
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR12G02240.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.65.4e-1376123451
                      XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                       k++r+   NReA r++Rq+Kka +++Leekvk+L a N++L k+l+ 
  LPERR12G02240.1  76 PKKTRKPLGNREAVRKYRQKKKAHTAHLEEKVKKLHAINQQLVKKLQG 123
                      5999***************************************99974 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.4E-1473141No hitNo description
SMARTSM003389.7E-1273140IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.00275122IPR004827Basic-leucine zipper domain
PfamPF077161.7E-1276130IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.45E-877123No hitNo description
CDDcd146866.21E-1278131No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MDDGEIELSS QMMFSNPEPH ISLDDFLASI RTTCTHTHTC NPPGPSATAH THTCYHTHTR  60
VFSSDDDSCG GNKAKPKKTR KPLGNREAVR KYRQKKKAHT AHLEEKVKKL HAINQQLVKK  120
LQGQAALEAE VTRLRTLLVD VRAKIDGALG SYPFQSQCGD ANVSSCDGMS QCFAGKPVNC  180
HISPDSGQNL VVPHALSPSD AVGSFMVSSN TRAE
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3780341e-173FQ378034.1 Oryza glaberrima chromosome 11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619735.11e-111PREDICTED: uncharacterized protein LOC107279776
SwissprotQ8VY762e-54BZP19_ARATH; Basic leucine zipper 19
TrEMBLA0A0D9XWQ31e-161A0A0D9XWQ3_9ORYZ; Uncharacterized protein
STRINGBGIOSGA036957-PA3e-92(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2094757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.11e-37bZIP family protein